Rattus norvegicus (rat): 64633 Help Entry 64633             CDS       T01003                                  Symbol Rab5a Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism rno  Rattus norvegicus (rat) Pathway rno04014   Ras signaling pathway rno04137   Mitophagy - animal rno04144   Endocytosis rno04145   Phagosome rno04148   Efferocytosis rno04962   Vasopressin-regulated water reabsorption rno05014   Amyotrophic lateral sclerosis rno05022   Pathways of neurodegeneration - multiple diseases rno05132   Salmonella infection rno05146   Amoebiasis rno05152   Tuberculosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     64633 (Rab5a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     64633 (Rab5a)    04145 Phagosome     64633 (Rab5a)    04137 Mitophagy - animal     64633 (Rab5a)    04148 Efferocytosis     64633 (Rab5a)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     64633 (Rab5a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     64633 (Rab5a)    05152 Tuberculosis     64633 (Rab5a)   09174 Infectious disease: parasitic    05146 Amoebiasis     64633 (Rab5a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     64633 (Rab5a)    05022 Pathways of neurodegeneration - multiple diseases     64633 (Rab5a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     64633 (Rab5a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     64633 (Rab5a)    04031 GTP-binding proteins [BR:rno04031]     64633 (Rab5a) Membrane trafficking [BR:rno04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     64633 (Rab5a)  Endosome - Lysosome transport     64633 (Rab5a) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    64633 (Rab5a)   Exosomal proteins of other body fluids (saliva and urine)    64633 (Rab5a)   Exosomal proteins of colorectal cancer cells    64633 (Rab5a)   Exosomal proteins of bladder cancer cells    64633 (Rab5a) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     64633 (Rab5a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  64633 NCBI-ProteinID:  NP_073183 RGD:  620936 Ensembl:  ENSRNOG00000057056 UniProt:  M0RC99 A0A8I5ZS76 LinkDB All DBs Position 9:6720057..6749456 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFSRAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPAQPARSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactggttcttctaggagagtctgctgttggcaaatcaagtctggtgcttcgcttt gtgaaaggccaatttcatgagtttcaagagagtaccattggggctgcctttctaacccaa actgtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggccaagaa cggtatcatagcctagcaccaatgtactaccgaggagcacaagccgccatagttgtgtat gatattacaaatgaggagtccttttcgagagcaaaaaactgggttaaagaacttcaaagg caagcaagtcctaatattgtgatagctttgtcaggaaacaaggctgacttagcaaataaa agagctgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg gagacatcagctaagacatcaatgaatgtaaatgaaatatttatggcaatagctaaaaag ctgccaaagaacgaaccacaaaatccaggcgcaaactcagccagaggacgaggagtagac cttactgagcctgcacagccagccagaagccagtgttgtagtaactga

DBGET integrated database retrieval system