Rattus norvegicus (rat): 65129 Help Entry 65129             CDS       T01003                                  Symbol Cldn1 Name (RefSeq) claudin-1   KO K06087   claudin Organism rno  Rattus norvegicus (rat) Pathway rno03272   Virion - Hepatitis viruses rno04514   Cell adhesion molecules rno04530   Tight junction rno04670   Leukocyte transendothelial migration rno05160   Hepatitis C Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     65129 (Cldn1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     65129 (Cldn1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     65129 (Cldn1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     65129 (Cldn1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     65129 (Cldn1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:rno03037]     65129 (Cldn1)    04147 Exosome [BR:rno04147]     65129 (Cldn1) Cilium and associated proteins [BR:rno03037]  Other cilia and associated proteins   Stereociliary proteins    65129 (Cldn1) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    65129 (Cldn1)   Exosomal proteins of colorectal cancer cells    65129 (Cldn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC CD20 SUR7 DUF3185 TMEM174 Amastin DUF2207_C DUF4064 Phage_holin_5_2 Motif Other DBs NCBI-GeneID:  65129 NCBI-ProteinID:  NP_113887 RGD:  68422 Ensembl:  ENSRNOG00000001926 UniProt:  P56745 A6JRZ0 LinkDB All DBs Position 11:87926376..87941533 Genome browser AA seq 211 aa AA seqDB search MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAV IGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggttgcagcttctgggtttcatcctggcttcgctgggatggatcggc tctatcgtcagcactgccctgccccaatggaagatttactcctatgctggggacaacatc gtgactgctcaggccatctacgagggactgtggatgtcctgcgtttcgcaaagcaccggg cagatacagtgcaaagtcttcgactccttgctgaatctgaatagtactttgcaggcaacc agagccttgatggtaattggcatcctgctggggctgatcgcaatctttgtgtccaccatt ggcatgaagtgcatgaggtgcttagaagatgatgaagtgcaaaagatgtggatggctgtc atcgggggcataatatttgtaatttcaggtctggcgacattagtggccacagcatggtat ggaaatagaattgttcaagaattctatgaccccatgacccctgtcaatgccaggtatgaa tttggccaggctctctttactggctgggctgctgcctccctctgcctcctgggaggtgcc ctactttcctgctcctgtccccggaaaacaacctcttacccaacaccacggccttatccc aagccaacaccttctagtgggaaagactacgtgtga

DBGET integrated database retrieval system