Rattus norvegicus (rat): 652921 Help Entry 652921            CDS       T01003                                  Symbol Defb37 Name (RefSeq) beta-defensin 37 precursor   KO K23125   beta-defensin 1 Organism rno  Rattus norvegicus (rat) Pathway rno02010   ABC transporters rno05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     652921 (Defb37)  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     652921 (Defb37)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:rno02000]     652921 (Defb37)    03037 Cilium and associated proteins [BR:rno03037]     652921 (Defb37) Transporters [BR:rno02000]  Other transporters   Pores ion channels [TC:1]    652921 (Defb37) Cilium and associated proteins [BR:rno03037]  Motile cilia and associated proteins   Sperm associated proteins    652921 (Defb37) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  652921 NCBI-ProteinID:  NP_001398743 RGD:  1560790 Ensembl:  ENSRNOG00000038115 UniProt:  F7FEH8 A6IWA9 LinkDB All DBs Position 16:77485949..77499215 Genome browser AA seq 63 aa AA seqDB search MKISCFLLLVLSLSCFQINPFAVLDTRVCIEKRNTCHILQCPRFRDVVGTCYEGKGKCCH KYF NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgaagatctcctgctttctgctgctggtcctctctctctcctgcttccagatcaaccca tttgctgtccttgacacaagagtatgcattgagaagagaaacacctgtcacatactccag tgcccaagatttcgtgatgtagtcggcacctgttatgagggaaaaggcaaatgttgccac aaatacttttga

DBGET integrated database retrieval system