Rattus norvegicus (rat): 679934 Help Entry 679934            CDS       T01003                                  Symbol Brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism rno  Rattus norvegicus (rat) Pathway rno04810   Regulation of actin cytoskeleton rno05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rno00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     679934 (Brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     679934 (Brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 SPX DUF7310 Hydro_N_hd Matrilin_ccoil Motif Other DBs NCBI-GeneID:  679934 NCBI-ProteinID:  NP_001182405 RGD:  1598136 Ensembl:  ENSRNOG00000010184 UniProt:  A6IBT1 D3ZUP5 LinkDB All DBs Position 4:148306436..148321668 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccggtgcagcgagagattcaccaggactgggcgaaccgggag tacattgagatcatcaccagcagcatcaagaaaatctcggactttctcaactctttcgat atgtcttgtcgttcaagactcgcaacactgaatgagaaattgacagcccttgaacggaga atagagtacattgaagcgagggtgacaaagggtgagactctcacctag

DBGET integrated database retrieval system