Rattus norvegicus (rat): 680322 Help Entry 680322            CDS       T01003                                  Symbol H2ac12 Name (RefSeq) H2A clustered histone 12   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     680322 (H2ac12)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     680322 (H2ac12)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     680322 (H2ac12)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     680322 (H2ac12)   09165 Substance dependence    05034 Alcoholism     680322 (H2ac12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     680322 (H2ac12)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     680322 (H2ac12) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     680322 (H2ac12) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    680322 (H2ac12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone Histone_ABTB CBFD_NFYB_HMF Clp_N Motif Other DBs NCBI-GeneID:  680322 NCBI-ProteinID:  NP_001395655 RGD:  1593006 Ensembl:  ENSRNOG00000066420 UniProt:  M0RDM4 A6KNB5 LinkDB All DBs Position 17:47182193..47182658 Genome browser AA seq 128 aa AA seqDB search MSGRGKQGSKARAKAKTRSFRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKVK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaagcagggcagcaaggctcgcgccaaggccaagacccgctccttc cgggccggcctgcaattcccggtgggtcgcgtgcaccggctgctccgcaagggcaactac tccgagcgggtgggcgccggcgccccagtgtatctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcgagggacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggcggtgctgctgcccaagaag acggagagccaccacaaggttaagtga

DBGET integrated database retrieval system