KEGG   Rattus norvegicus (rat): 682076
Entry
682076            CDS       T01003                                 

Gene name
Mnx1
Definition
(RefSeq) motor neuron and pancreas homeobox protein 1
  KO
K08025  homeobox protein HB9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    682076 (Mnx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    682076 (Mnx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    682076 (Mnx1)
SSDB
Motif
Pfam: Homeodomain QLQ
Other DBs
NCBI-GeneID: 682076
NCBI-ProteinID: NP_001258203
RGD: 1588091
Ensembl: ENSRNOG00000046959
LinkDB
Position
4
AA seq 403 aa
MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLAATPSGPGRGGSGGGGTSSGASRSCS
PASSEATAAPGDRLRAESPSPPRLLTAHCALLPKPGFLGAGGGGGAAGGPGTPHHHAHPG
AAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAGQHP
ALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAGMILPKMPDFSSQAQSNLLGK
CRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSK
KAKEQAAQEAEKQKGSGGGAGKGGTEEKTEEELLGPPVSGDKASGRRLRDLRDSDPDEDE
DDEEDHFPYSNGVGAHAASSDCSSEDDSPPPRPGGPGHQPLPQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggaaaaatccaaaaatttccgcatcgacgccttgctggcggtggatcccccgcgagcc
gcctccacgcagagcgcgcctctggccttggtcacttccctcgccgctacaccatctggt
cccggccgcggcggtagcggtggcgggggaaccagtagcggggcgagccgcagctgcagt
cccgcgtcctcggaggccaccgcagcacccggtgatagactgagggctgagagcccgtcg
cctccgcgcttgctgactgcacactgcgcgctgctgcccaagcctggatttctaggcgcc
gggggaggcggcggcgcggcgggtgggccgggcactccacaccaccacgcgcaccctggt
gccgccgccgccgccgctgctgccgcggctgccgccgcagccgggggcctggcactgggg
ctgcaccccgggggcgcacagggcggcgcgggcctcccggcacaggcagctctctacgga
cacccggtctacagttactcggcagcagctgcagcggccgcgctagctggccagcacccg
gcgctttcctactcgtatcctcaggtgcagggcgcgcaccctgctcaccctgccgacccc
atcaagctgggtgccggcacctttcaactggaccagtggctgcgcgcgtctactgcgggc
atgatcctgcccaagatgccggacttcagctcccaggcgcaatcgaacctcttggggaag
tgccgaaggcctcgcacggccttcaccagccagcagctgttggagctggaacaccagttc
aagctcaacaagtacctgtcgcgacccaagcgttttgaggtggctacctcgctcatgctc
accgagacccaggtgaagatttggttccagaaccgccgaatgaaatggaaacgcagcaaa
aaggccaaagagcaggctgcgcaggaggcagagaagcagaagggcagcggcgggggcgcc
ggcaaaggcggcactgaggagaagacggaggaggagctgctgggacctccagtttcgggg
gacaaggccagcggccgtcgcctgcgggacttgcgggacagtgacccagatgaggatgag
gatgatgaagaagaccacttcccctacagcaatggggtcggtgcccacgctgcctcatcc
gattgctcatctgaggacgactcgcctcccccaaggccaggagggcccgggcaccaacct
ctgccccagtag

DBGET integrated database retrieval system