Rattus norvegicus (rat): 688430 Help Entry 688430            CDS       T01003                                  Symbol Cfl1l1 Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism rno  Rattus norvegicus (rat) Pathway rno04360   Axon guidance rno04666   Fc gamma R-mediated phagocytosis rno04810   Regulation of actin cytoskeleton rno05133   Pertussis rno05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:rno00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     688430 (Cfl1l1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     688430 (Cfl1l1)   09158 Development and regeneration    04360 Axon guidance     688430 (Cfl1l1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     688430 (Cfl1l1)   09171 Infectious disease: bacterial    05133 Pertussis     688430 (Cfl1l1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     688430 (Cfl1l1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:rno04812]     688430 (Cfl1l1)    04147 Exosome [BR:rno04147]     688430 (Cfl1l1) Membrane trafficking [BR:rno04131]  Others   Actin-binding proteins    Others     688430 (Cfl1l1) Cytoskeleton proteins [BR:rno04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      688430 (Cfl1l1) Exosome [BR:rno04147]  Exosomal proteins   Proteins found in most exosomes    688430 (Cfl1l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  688430 NCBI-ProteinID:  XP_038938552 RGD:  1588858 LinkDB All DBs Position 8:complement(117368547..117372971) Genome browser AA seq 165 aa AA seqDB search MASGVAVSDGVIKVFNDMKVCKSSMPEVKKHKKTVLFCLSEDKKNIILEEGKEILVGDVG QTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWTPESAPLKSKMIYASSK DAIKKKLTGIKHELQANCYEEVKDCCTLAEKLGGRAVISLEGKPL NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtgtctgatggagtcatcaaggtgttcaatgacatgaaagtt tgcaagtcttcaatgccagaagtgaagaaacacaagaagacagtgctcttttgcctgagt gaggacaagaagaacatcatcctggaggagggcaaggagattctggtaggagatgtgggg cagactgtggatgacccctacaccacttttgtcaagatgctgccagacaaggactgccgc tatgctctctatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtattc atcttctggacccctgagagtgcaccccttaagagcaaaatgatctatgccagctccaag gatgccatcaagaagaaactgacaggaatcaagcatgaattacaagctaactgctacgag gaggtcaaggactgctgcaccctggcagagaaactaggtggcagggctgtcatttccctg gagggcaagcctttgtga

DBGET integrated database retrieval system