Rattus norvegicus (rat): 690131 Help Entry 690131            CDS       T01003                                  Symbol Hist2h2aa2 Name (RefSeq) histone H2A type 2-A   KO K11251   histone H2A Organism rno  Rattus norvegicus (rat) Pathway rno03082   ATP-dependent chromatin remodeling rno04217   Necroptosis rno04613   Neutrophil extracellular trap formation rno05034   Alcoholism rno05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     690131 (Hist2h2aa2)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     690131 (Hist2h2aa2)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     690131 (Hist2h2aa2)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     690131 (Hist2h2aa2)   09165 Substance dependence    05034 Alcoholism     690131 (Hist2h2aa2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rno03036]     690131 (Hist2h2aa2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     690131 (Hist2h2aa2) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Nucleosome assembly factors    Histones     690131 (Hist2h2aa2) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    690131 (Hist2h2aa2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Histone_ABTB Clp_N Motif Other DBs NCBI-GeneID:  690131 NCBI-ProteinID:  NP_001395796 RGD:  1584037 UniProt:  K7S2S2 LinkDB All DBs Position 2:complement(186490181..186490764) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtcc cgcgccgggctgcagttcccagtgggtcgcgtgcaccggctgctgcgcaagggcaactac gcggagcgcgtgggcgccggcgcgccggtatacatggcggcggtgctggagtacctgacc gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaagaactcaacaagctgctgggcaaa gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acggagagccaccataaggcgaagggcaagtga

DBGET integrated database retrieval system