Rattus norvegicus (rat): 691455 Help Entry 691455            CDS       T01003                                  Symbol Calml4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism rno  Rattus norvegicus (rat) Pathway rno04014   Ras signaling pathway rno04015   Rap1 signaling pathway rno04020   Calcium signaling pathway rno04022   cGMP-PKG signaling pathway rno04024   cAMP signaling pathway rno04070   Phosphatidylinositol signaling system rno04114   Oocyte meiosis rno04218   Cellular senescence rno04261   Adrenergic signaling in cardiomyocytes rno04270   Vascular smooth muscle contraction rno04371   Apelin signaling pathway rno04625   C-type lectin receptor signaling pathway rno04713   Circadian entrainment rno04720   Long-term potentiation rno04722   Neurotrophin signaling pathway rno04728   Dopaminergic synapse rno04740   Olfactory transduction rno04744   Phototransduction rno04750   Inflammatory mediator regulation of TRP channels rno04910   Insulin signaling pathway rno04912   GnRH signaling pathway rno04915   Estrogen signaling pathway rno04916   Melanogenesis rno04921   Oxytocin signaling pathway rno04922   Glucagon signaling pathway rno04924   Renin secretion rno04925   Aldosterone synthesis and secretion rno04970   Salivary secretion rno04971   Gastric acid secretion rno05010   Alzheimer disease rno05012   Parkinson disease rno05022   Pathways of neurodegeneration - multiple diseases rno05031   Amphetamine addiction rno05034   Alcoholism rno05133   Pertussis rno05152   Tuberculosis rno05163   Human cytomegalovirus infection rno05167   Kaposi sarcoma-associated herpesvirus infection rno05170   Human immunodeficiency virus 1 infection rno05200   Pathways in cancer rno05214   Glioma rno05417   Lipid and atherosclerosis rno05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     691455 (Calml4)    04015 Rap1 signaling pathway     691455 (Calml4)    04371 Apelin signaling pathway     691455 (Calml4)    04020 Calcium signaling pathway     691455 (Calml4)    04070 Phosphatidylinositol signaling system     691455 (Calml4)    04024 cAMP signaling pathway     691455 (Calml4)    04022 cGMP-PKG signaling pathway     691455 (Calml4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     691455 (Calml4)    04218 Cellular senescence     691455 (Calml4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     691455 (Calml4)   09152 Endocrine system    04910 Insulin signaling pathway     691455 (Calml4)    04922 Glucagon signaling pathway     691455 (Calml4)    04912 GnRH signaling pathway     691455 (Calml4)    04915 Estrogen signaling pathway     691455 (Calml4)    04921 Oxytocin signaling pathway     691455 (Calml4)    04916 Melanogenesis     691455 (Calml4)    04924 Renin secretion     691455 (Calml4)    04925 Aldosterone synthesis and secretion     691455 (Calml4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     691455 (Calml4)    04270 Vascular smooth muscle contraction     691455 (Calml4)   09154 Digestive system    04970 Salivary secretion     691455 (Calml4)    04971 Gastric acid secretion     691455 (Calml4)   09156 Nervous system    04728 Dopaminergic synapse     691455 (Calml4)    04720 Long-term potentiation     691455 (Calml4)    04722 Neurotrophin signaling pathway     691455 (Calml4)   09157 Sensory system    04744 Phototransduction     691455 (Calml4)    04740 Olfactory transduction     691455 (Calml4)    04750 Inflammatory mediator regulation of TRP channels     691455 (Calml4)   09159 Environmental adaptation    04713 Circadian entrainment     691455 (Calml4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     691455 (Calml4)   09162 Cancer: specific types    05214 Glioma     691455 (Calml4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     691455 (Calml4)    05163 Human cytomegalovirus infection     691455 (Calml4)    05167 Kaposi sarcoma-associated herpesvirus infection     691455 (Calml4)   09171 Infectious disease: bacterial    05133 Pertussis     691455 (Calml4)    05152 Tuberculosis     691455 (Calml4)   09164 Neurodegenerative disease    05010 Alzheimer disease     691455 (Calml4)    05012 Parkinson disease     691455 (Calml4)    05022 Pathways of neurodegeneration - multiple diseases     691455 (Calml4)   09165 Substance dependence    05031 Amphetamine addiction     691455 (Calml4)    05034 Alcoholism     691455 (Calml4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     691455 (Calml4)    05418 Fluid shear stress and atherosclerosis     691455 (Calml4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rno01009]     691455 (Calml4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     691455 (Calml4)    03036 Chromosome and associated proteins [BR:rno03036]     691455 (Calml4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     691455 (Calml4) Protein phosphatases and associated proteins [BR:rno01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      691455 (Calml4) Membrane trafficking [BR:rno04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     691455 (Calml4) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      691455 (Calml4) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    691455 (Calml4) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_8 SAPC2_N AIF-1 CFAP251_C EH YuzC EF-hand_11 EF-hand_EFHB_C Motif Other DBs NCBI-GeneID:  691455 NCBI-ProteinID:  NP_001121047 RGD:  1583918 UniProt:  B0BNB8 LinkDB All DBs Position 8:72218870..72230650 Genome browser AA seq 153 aa AA seqDB search MAKFLSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDK NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHK EVDELFKEAGIEPNGQVKYDTFIQRITLPVRDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagttcctttcccaggagcaaattaatgagtacaaggaatgcttctccctgtat gacaagcagcaaagagggaagattaaggccacagatctcctggtgtccatgaggtgcctg ggggccagccccacacctggggaagtgcagcggcacctgcagactcatggaatagacaag aacggagaactggatttctccaccttcctgaccattatgcacatgcaaatcaagcaagag gacccaaagaaagaaatccttctggccatgctgatgacagacaaggagaagaaaggttac atcatggcgtctgagttgcggtcgaaactcatgaaactgggagagaagctcactcacaaa gaagtggatgagcttttcaaggaagcgggcatcgaacctaacggccaagtgaaatatgac acgtttatccagaggatcaccctgcccgtgcgagactactag

DBGET integrated database retrieval system