Rattus norvegicus (rat): 79120 Help Entry 79120             CDS       T01003                                  Symbol Arf4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism rno  Rattus norvegicus (rat) Pathway rno04144   Endocytosis Brite KEGG Orthology (KO) [BR:rno00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     79120 (Arf4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     79120 (Arf4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     79120 (Arf4)    04031 GTP-binding proteins [BR:rno04031]     79120 (Arf4) Membrane trafficking [BR:rno04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     79120 (Arf4) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    79120 (Arf4)   Exosomal proteins of other body fluids (saliva and urine)    79120 (Arf4)   Exosomal proteins of colorectal cancer cells    79120 (Arf4) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     79120 (Arf4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Roc G-alpha Ras Gtr1_RagA MMR_HSR1 6PF2K Motif Other DBs NCBI-GeneID:  79120 NCBI-ProteinID:  NP_077065 RGD:  621275 Ensembl:  ENSRNOG00000012623 UniProt:  P61751 A6KMJ6 LinkDB All DBs Position 16:1903238..1920012 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAAVLQKMLLEDELQDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctctctcttctcgcgcctcttcggcaagaagcagatgcgcatt ttgatggttggattggatgctgcgggcaagacgacgattctgtataaactgaaactaggg gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtttgggatgttggtggtcaagataaaattaggcctctctggaggcat tacttccagaatacccagggtctcattttcgtggtagatagcaatgatcgtgaaagaatt caggaaggagcagccgtgctgcagaaaatgcttctggaagatgagctgcaggatgctgtg ctgctgctttttgccaacaaacaggatttgccaaatgctatggccatcagtgagatgaca gacaagttaggtcttcagtctctccggaacagaacatggtatgtccaagccacttgtgct acacaaggaactggtctgtacgaggggctggattggctgtcaaatgaactttcaaaacgc taa

DBGET integrated database retrieval system