Rattus norvegicus (rat): 79434 Help Entry 79434             CDS       T01003                                  Symbol Rab11b Name (RefSeq) ras-related protein Rab-11B   KO K07905   Ras-related protein Rab-11B Organism rno  Rattus norvegicus (rat) Pathway rno04144   Endocytosis rno04152   AMPK signaling pathway rno04962   Vasopressin-regulated water reabsorption rno05164   Influenza A Brite KEGG Orthology (KO) [BR:rno00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     79434 (Rab11b)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     79434 (Rab11b)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     79434 (Rab11b)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     79434 (Rab11b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rno04131]     79434 (Rab11b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rno04147]     79434 (Rab11b)    04031 GTP-binding proteins [BR:rno04031]     79434 (Rab11b) Membrane trafficking [BR:rno04131]  Protein recycling   Rab GTPases and associated proteins    Rab GTPases     79434 (Rab11b) Exosome [BR:rno04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    79434 (Rab11b)   Exosomal proteins of other body fluids (saliva and urine)    79434 (Rab11b)   Exosomal proteins of colorectal cancer cells    79434 (Rab11b) GTP-binding proteins [BR:rno04031]  Small (monomeric) G-proteins   Rab Family    Rab11/25 [OT]     79434 (Rab11b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_22 PduV-EutP AAA_16 ABC_tran AAA_14 Gtr1_RagA Csa3_N FeoB_N NTPase_1 TniB AAA_24 DUF3289 FAD-SLDH AAA_21 Motif Other DBs NCBI-GeneID:  79434 NCBI-ProteinID:  NP_116006 RGD:  68369 Ensembl:  ENSRNOG00000007648 UniProt:  O35509 A6KQH9 LinkDB All DBs Position 7:complement(15223613..15236754) Genome browser AA seq 218 aa AA seqDB search MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM LVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQ IADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atggggacccgggacgacgagtacgattacctattcaaagtggtgcttattggggactca ggtgtaggtaagagcaacctgctgtcacgcttcaccagaaacgagttcaacctagagagc aagagcaccattggagtggagtttgccactcgcagcattcaggtggacggcaagaccatc aaggctcagatctgggatactgctggccaggagcgctaccgtgccattacctctgcgtac taccgtggtgcagtgggtgcactgctggtatatgacattgccaagcacttgacatatgag aatgtggagcgctggctgaaggagctgcgggatcatgcagatagcaacattgttatcatg ctggtgggcaacaagagcgacctgcgccatcttcgggctgtgcccactgacgaggcccgt gcctttgcagaaaagaacaacttgtccttcattgagacctcagccttggattccaccaat gtagaggaagcattcaagaacatcctcacagaaatctaccgtattgtgtcacagaagcaa attgctgaccgtgcagctcatgatgagtcccctggcaacaatgtggtggacatcagtgtg ccacccaccaccgatggacagaaacccaataagctgcagtgctgccagaacctgtga

DBGET integrated database retrieval system