Rattus norvegicus (rat): 81650 Help Entry 81650             CDS       T01003                                  Symbol Csnk2b Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism rno  Rattus norvegicus (rat) Pathway rno03008   Ribosome biogenesis in eukaryotes rno03083   Polycomb repressive complex rno04064   NF-kappa B signaling pathway rno04137   Mitophagy - animal rno04310   Wnt signaling pathway rno04520   Adherens junction rno05010   Alzheimer disease rno05020   Prion disease rno05022   Pathways of neurodegeneration - multiple diseases rno05162   Measles rno05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     81650 (Csnk2b)   09126 Chromosome    03083 Polycomb repressive complex     81650 (Csnk2b)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     81650 (Csnk2b)    04064 NF-kappa B signaling pathway     81650 (Csnk2b)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     81650 (Csnk2b)   09144 Cellular community - eukaryotes    04520 Adherens junction     81650 (Csnk2b)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     81650 (Csnk2b)   09172 Infectious disease: viral    05162 Measles     81650 (Csnk2b)   09164 Neurodegenerative disease    05010 Alzheimer disease     81650 (Csnk2b)    05020 Prion disease     81650 (Csnk2b)    05022 Pathways of neurodegeneration - multiple diseases     81650 (Csnk2b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:rno03009]     81650 (Csnk2b)    03036 Chromosome and associated proteins [BR:rno03036]     81650 (Csnk2b) Ribosome biogenesis [BR:rno03009]  Eukaryotic type   90S particles    Kinase     81650 (Csnk2b) Chromosome and associated proteins [BR:rno03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      81650 (Csnk2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  81650 NCBI-ProteinID:  NP_001030315 RGD:  619978 Ensembl:  ENSRNOG00000000847 Vega:  OTTRNOG00000000290 UniProt:  P67874 Q68G11 N0E459 Structure PDBPDBj LinkDB All DBs Position 20:3704833..3709999 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagtagctctgaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa ttcttctgtgaggtggatgaagactacatccaggacaaatttaatcttactggactcaat gagcaggtgcctcactatcgacaagccctagacatgatcttggacctggaacctgatgaa gagctggaagacaaccccaaccagagtgacttgattgagcaggcggccgagatgctctat gggttgatccacgcccgctacatcctcaccaaccggggcattgcacaaatgttggaaaag taccagcaaggagactttggctactgtcctcgagtatactgtgagaaccagccgatgctt cccatcggcctttcggacatcccaggagaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcctctaggcaccaccacacggatggcgcatacttcggc actggtttccctcacatgctcttcatggtgcatcccgagtaccggcccaagcggccggcc aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system