KEGG   Rattus norvegicus (rat): 81654
Entry
81654             CDS       T01003                                 

Gene name
Dlat
Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    81654 (Dlat)
   00020 Citrate cycle (TCA cycle)
    81654 (Dlat)
   00620 Pyruvate metabolism
    81654 (Dlat)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     81654 (Dlat)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 81654
NCBI-ProteinID: NP_112287
RGD: 619859
Ensembl: ENSRNOG00000009994
UniProt: P08461
LinkDB
Position
8
AA seq 632 aa
MWRVCARRVQSAVPRAGFRARWATLKGPRTGPAAVRCGSGIPSYGVRSLCGWSYGSATVP
RNRILQQLLGSPSRRSYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISEGDLIAEVE
TDKATVGFESLEECYMAKILVPEGTRDVPVGSIICITVEKPQDIEAFKNYTLDSATAATQ
AAPAPAAAPAAAPAAPSASAPGSSYPVHMQIVLPALSPTMTMGTVQRWEKKVGEKLSEGD
LLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKQEDIAAFADYRPTE
VTSLKPQAPPPVPPPVAAVPPIPQPLAPTPSAAPAGPKGRVFVSPLAKKLAAEKGIDLTQ
VKGTGPEGRIIKKDIDSFVPTKAAPAAAAAAPPGPRVAPTPAGVFIDIPISNIRRVIAQR
LMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKGKISVNDFIIKASALACLKVPEAN
SSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLASKAREGKLQP
HEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKGFDVASVMSVT
LSCDHRVVDGAVGAQWLAEFKKYLEKPVTMLL
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcggagggtgcagagtgctgttcccagggccgggttcagggct
cggtgggcaactttgaagggcccgcggaccggccccgccgcagttcgttgcggcagtggg
atacccagctatggggtccgctcgttgtgcggctggagctacggctctgccaccgtccca
cgtaaccgcatactgcaacaactcctggggtcgcccagccgccgctcttatagcctccct
ccgcaccagaaggttccactaccttcactttcccctacaatgcaggcaggcaccatagcc
cgctgggaaaaaaaagaaggggaaaaaatcagtgagggtgatctaattgcagaggttgaa
actgataaagccactgttggatttgagagcttggaggagtgctatatggcaaagatcctt
gttcctgaggggaccagagatgttccagtaggatctatcatttgtatcacagttgaaaag
cctcaggatattgaggcctttaaaaattatacattggattcagcaacagctgccacacag
gcagccccagccccagctgcagctccagctgctgccccagctgcaccttctgcaagtgct
ccaggtagctcctatcccgttcacatgcagattgttcttcctgccctctccccaaccatg
accatgggcaccgtccagaggtgggaaaagaaagtgggagagaagctgagtgaaggagac
ttgctggcagagatagagaccgacaaggccaccataggctttgaagtacaagaagaaggt
tatctggcaaaaatcctggtccctgaaggcacaagggatgttcctctgggaaccccgcta
tgtatcatagtagaaaaacaggaagatatagcagcatttgcagactacaggccaacagaa
gtgaccagcttaaagccacaggcaccaccacctgtcccacccccagtggcagctgttcct
cccatcccccagcctttagcacctaccccctcagccgctcctgctggaccaaagggaagg
gtgttcgttagccctcttgcaaagaaattggcagcagagaaagggattgacctcacccaa
gttaaagggacgggaccagaaggcagaatcatcaagaaggacattgactcttttgtgcct
actaaggctgctcctgccgctgcagcagctgctcccccgggtccaagagtggcaccaact
cctgcaggtgtcttcatagacatccccatcagcaacattcgtcgagtgattgcgcagagg
ctcatgcagtcgaagcagactatacctcattattacctttctgttgatgtaaatatggga
gaggtgctgttggtgcggaaggaacttaataagatgcttgaaggtaaaggaaaaatctcc
gtcaatgacttcatcataaaagcttcagctttggcctgcctgaaagttcctgaagcaaac
tcatcttggatggacacagttatacgacaaaatcatgtggttgatgtcagcgttgctgtc
agtacccctgcaggacttatcacccctattgtgtttaatgcacacataaaaggactggaa
accattgctagtgatgttgtttctttagcctccaaagcaagagagggtaaacttcagcct
cacgagttccagggtgggacatttacaatctccaacttagggatgttcggaattaagaat
ttctctgcgattattaacccacctcaggcatgtattttggcaattggtgcttccgaggat
aaactgatccctgcagataatgagaaaggctttgacgtggctagtgtgatgtctgtcaca
ctcagctgtgatcatcgagttgtggatggagcagttggagcccagtggcttgctgaattc
aaaaagtaccttgaaaagcctgtaactatgttattataa

DBGET integrated database retrieval system