Rattus norvegicus (rat): 81807 Help Entry 81807             CDS       T01003                                  Symbol Elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism rno  Rattus norvegicus (rat) Pathway rno04066   HIF-1 signaling pathway rno04120   Ubiquitin mediated proteolysis rno05170   Human immunodeficiency virus 1 infection rno05200   Pathways in cancer rno05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:rno00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     81807 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     81807 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     81807 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     81807 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     81807 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:rno04121]     81807 (Elob)    03400 DNA repair and recombination proteins [BR:rno03400]     81807 (Elob) Ubiquitin system [BR:rno04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      81807 (Elob)    Cul5 complex      81807 (Elob) DNA repair and recombination proteins [BR:rno03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      81807 (Elob) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  81807 NCBI-ProteinID:  NP_112391 RGD:  621200 Ensembl:  ENSRNOG00000004814 UniProt:  P62870 LinkDB All DBs Position 10:complement(13353413..13358484) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctcatgatccggcgccacaagaccaccatctttacggacgccaaggag tcgagcacggtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggccgccagag gagcagcggctgtacaaggacgaccagctccttgatgatggaaaaactctgggcgaatgt ggcttcaccagtcagacagcaaggccacaggccccagccacagtgggcctggcctttcga gcagatgacacctttgaagcgctgcgtattgaacccttctccagccctccggagcttcca gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system