Rattus norvegicus (rat): 83462 Help Entry 83462             CDS       T01003                                  Symbol Dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism rno  Rattus norvegicus (rat) Pathway rno04814   Motor proteins rno05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rno00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     83462 (Dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     83462 (Dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:rno03037]     83462 (Dynlt1)    04812 Cytoskeleton proteins [BR:rno04812]     83462 (Dynlt1) Cilium and associated proteins [BR:rno03037]  Motile cilia and associated proteins   Dynein arm    83462 (Dynlt1) Cytoskeleton proteins [BR:rno04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      83462 (Dynlt1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  83462 NCBI-ProteinID:  NP_112608 RGD:  620261 Ensembl:  ENSRNOG00000018207 UniProt:  Q9Z336 B2RYR9 LinkDB All DBs Position 1:complement(49292093..49299051) Genome browser AA seq 113 aa AA seqDB search MEDFQASEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagacttccaggcctccgaggagactgcatttgttgtggatgaagtgagcaacatt gtaaaggaggctatagaaagtgccatcggcggtaacgcctaccagcacagcaaagtcaac cagtggaccactaatgttgtagaacagactttgagccaactcaccaaactggggaaacca tttaaatacattgtgacctgtgtgatcatgcagaagaatggtgctgggttacacaccgca agttcctgcttctgggacagctccacggacgggagctgcacagtccgatgggagaacaag accatgtactgcatcgtcagtgccttcggactgtccatctga

DBGET integrated database retrieval system