KEGG   Rattus norvegicus (rat): 83630
Entry
83630             CDS       T01003                                 

Gene name
Pax4
Definition
(RefSeq) paired box protein Pax-4
  KO
K08032  paired box protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    83630 (Pax4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    83630 (Pax4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    83630 (Pax4)
SSDB
Motif
Pfam: PAX Homeodomain HTH_32 HTH_23 HTH_28 HTH_38
Other DBs
NCBI-GeneID: 83630
NCBI-ProteinID: NP_113987
RGD: 620433
Ensembl: ENSRNOG00000008020
UniProt: O88436
LinkDB
Position
4
AA seq 349 aa
MQQDGLSSVNQLGGLFVNGRPLPLDTRQQIVQLAIRGMRPCDISRSLKVSNGCVSKILGR
YYRTGVLEPKGIGGSKPRLATPAVVARIAQLKDEYPALFAWEIQRQLCAEGLCTQDKAPS
VSSINRVLRALQEDQRLHWTQLRSPAVLAPALPSPHSNCEAPRGPHPGTSHRNRTIFSPG
QAEALEKEFQRGQYPDSVVRGKLAAATSLPEDTVRVWFSNRRAKWRRQEKLKWETQMPGA
SQDLMVPKDSPGIISAQQSPGSVPSAALPVLEQLNPSFCQLCWGAVPDRCSSDTTSQACL
QPYWECHSLLPVASSSYMEFAWPCLTTHPVHHLIGGPGQAPSTYYLHWP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcagcaggacggtctcagcagtgtgaatcagctggggggactctttgtgaatggccgg
ccccttccactggacacccgacagcagattgtgcagctagcgataagagggatgcgaccc
tgtgacatctcacggagccttaaggtatctaacggctgtgtgagtaagatcctaggacgc
tactaccgcacaggagtcttggaacccaagggtattgggggaagcaaaccacgtctggcc
acacctgctgtggtggctcgaattgcccagctaaaggatgagtatccagctctttttgcc
tgggagatccaacgccagctttgtgctgaagggctttgtacccaggacaaggctcccagt
gtatcctctatcaatcgagtccttcgggcactacaggaagaccagaggttacactggaca
caacttagatctccagctgttttggctccagctcttcctagtccccacagtaactgtgag
gctccccgaggtccccacccggggaccagccacaggaatcggactatcttctccccgggc
caagctgaggcactggagaaagagttccagcgtgggcagtatccagattcagttgtccgt
ggaaagctggctgctgccacctctctgcctgaagacacagtgagggtctggttttccaac
agaagagccaaatggcgcagacaagagaagttgaaatgggaaacacagatgccaggtgct
tctcaggacctgatggtaccaaaagattctccagggatcatctctgcacagcagtcccct
ggcagtgtaccctcagcagccctgcctgtgctggaacaattgaatccttccttctgtcag
ctgtgctggggggcagtaccagacagatgttccagtgacaccacatcccaagcctgtctc
caaccctactgggaatgccactccctccttcctgtggcttcttcctcatacatggaattt
gcctggccctgcctcaccacccatcctgtgcatcatctgattggaggcccaggacaagcg
ccatcaacctattacttacactggccataa

DBGET integrated database retrieval system