KEGG   Rattus norvegicus (rat): 84019
Entry
84019             CDS       T01003                                 
Symbol
Nae1
Name
(RefSeq) NEDD8-activating enzyme E1 regulatory subunit
  KO
K04532  NEDD8-activating enzyme E1 regulatory subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84019 (Nae1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    84019 (Nae1)
Ubiquitin system [BR:rno04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   84019 (Nae1)
SSDB
Motif
Pfam: ThiF E1_4HB
Other DBs
NCBI-GeneID: 84019
NCBI-ProteinID: NP_114461
RGD: 619945
Ensembl: ENSRNOG00000033133
UniProt: A1L122
LinkDB
Position
19:446015..472145
AA seq 534 aa
MAQQGKILKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTII
DGNQVSGEDVGNNFFLQKCSIGKNRAQAAMEFLQELNSDVSGSFVEESPENLLDNDPSFF
CRFTIVVATQLLESTLLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNAL
EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKSYKEK
EDFRELIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQ
TPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSSKYIKLQNVYREKAKKDAAAVGNH
VAKLLQSVGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLHTVNKDEIISSMDNPD
NEIVLYLMLRAVDRFHKQHGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVH
EFCRYGAAEPHTVAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggctcagcaagggaagatactcaaggagcaaaagtacgaccggcagctgaggttgtgg
ggtgatcatggtcaagaagctttggaatctgctcacgtttgcttgataaatgccacagct
acaggaacggaaattcttaaaaacttggtactgccaggtataggatcatttacaattatc
gatggaaatcaggtcagcggagaagatgttggaaacaattttttccttcaaaaatgcagt
attggcaagaatcgagctcaagctgccatggaattcttacaagagctaaatagcgatgtc
tctggaagttttgtggaagagagtccagaaaaccttctagacaatgatccttcatttttc
tgtaggtttactattgtggttgcaactcagcttcttgaaagtacattactacgtttagca
gatgtcctctggaattcccagatccctcttttgatctgtaggacatatggcctagttggt
tatatgaggattattataaaagaacatccagtaatagaatctcatccagataatgcattg
gaggacctacgactagataagccatttcctgaactgagagaacattttcagtcttatgac
ttggaccatatggaaaaaaaggaccatagccatactccatggattgtgatcatagctaaa
tatttagcccagtggtatagtgagacaaatggacgaattcctaaaagttataaagaaaaa
gaggacttcagagaattgataagacaagggattttaaagaatgagaatggagctccagaa
gatgaagagaattttgaagaagctattaaaaatgtgaacacagcactaaatacaactcag
atcccaagcagtattgaagatatatttaatgatgatcgctgcataaatatcaccaaacag
accccatctttttggattttagctcgtgccttaaaggaatttgtggccaaggagggtcaa
ggaaatttacctgttcgaggcacaattcctgatatgattgcagattcaagcaaatacata
aaattgcagaatgtttatcgtgagaaagcaaagaaagatgctgctgctgtaggtaatcat
gttgccaaattgcttcagtctgttggccaggcaccagagtccatttcagagaaagaatta
aaactgctttgtagcaattctgcatttcttcgagtggtaagatgtcggtctttagctgaa
gagtatggtttgcatacagtcaacaaagatgaaattatttctagcatggacaatccggat
aatgagatagtcctgtacctaatgttgcgggctgttgatcgatttcataagcagcatggc
agatacccaggagtatctaactatcaagttgaagaagatatagggaagttgaagtcctgt
cttactggcttccttcaggaatatgggttgtctgtaatggtgaaggacgattatgtccat
gaattttgccggtacggagctgctgagccacacaccgttgctgcattcctgggaggagct
gctgctcaagaagttatcaaaataatcaccaaacaatttgtaatttttaacaatacttat
atttatagtggtatgtcacaaacttctgcaactttccaattgtag

DBGET integrated database retrieval system