Roseateles sp. L2-2: ACQZ13_04730 Help Entry ACQZ13_04730      CDS       T11386                                  Name (GenBank) tautomerase family protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rog  Roseateles sp. L2-2 Pathway rog00362   Benzoate degradation rog00621   Dioxin degradation rog01100   Metabolic pathways rog01120   Microbial metabolism in diverse environments rog01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:rog00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     ACQZ13_04730    00622 Xylene degradation     ACQZ13_04730    00621 Dioxin degradation     ACQZ13_04730 Enzymes [BR:rog01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      ACQZ13_04730 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  XUK40701 LinkDB All DBs Position complement(1015741..1015977) Genome browser AA seq 78 aa AA seqDB search MPYVNIKVTREGTVPGASATTPEQKAALIQGVSDLLFEVMGKPHHMTFVVIDEVELENWG VGGLPTTEFRRRQAGTPG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgccctacgtcaacatcaaggtgacccgcgagggcaccgtccccggcgccagcgccacc acgcccgagcagaaggcggccctgatccagggcgtcagcgatctgctgttcgaggtgatg gggaagccgcatcacatgaccttcgtcgtcatcgacgaggtcgagctcgagaactggggc gtcggcggcctgccgacgacggaattccgccgccgacaggccgggacgccgggctag

DBGET integrated database retrieval system