Roseovarius sp. THAF27: FIU89_10035 Help Entry FIU89_10035       CDS       T06352                                  Symbol acpP2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism roh  Roseovarius sp. THAF27 Pathway roh01100   Metabolic pathways roh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIU89_10035 (acpP2)    00074 Mycolic acid biosynthesis     FIU89_10035 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIU89_10035 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 MIF4G Motif Other DBs NCBI-ProteinID:  QFT80948 UniProt:  A0A5P9H0R4 LinkDB All DBs Position 2011294..2011554 Genome browser AA seq 86 aa AA seqDB search MDTKDKVIDIIAEQAVLEPSDVTMDSTLEELGIDSLGLVESIFAIEEAFDISVPFNANAP QESDFDISSVASIVAGIEKLVAEQKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggataccaaggacaaggtcatcgacatcattgccgagcaggcggtgctggagccgtct gacgtcacgatggacagcacgctggaggaactgggcatcgacagcctcggcctcgtcgaa agcattttcgccatcgaggaagccttcgacatctccgtgcccttcaacgccaacgcgccc caggaaagcgatttcgacatctcgtcggtcgcctccatcgttgcgggcatcgaaaagctg gtggcggaacagaaagcgtga

DBGET integrated database retrieval system