Roseateles amylovorans: N4261_21900 Help Entry N4261_21900       CDS       T08701                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism roi  Roseateles amylovorans Pathway roi01100   Metabolic pathways roi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N4261_21900 (acpP)    00074 Mycolic acid biosynthesis     N4261_21900 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N4261_21900 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  UXH77610 LinkDB All DBs Position complement(5287382..5287621) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVPEADVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDYAVKHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcatcgccgagcaactcggcgtgcccgaa gccgatgtgaccaatgagaaggccttcgtggccgacctgggcgccgattctctggacacc gtggaactggtgatggccctcgaagacgagttcggcatcgaaatcccggacgaagaagcc gaaaagatcaccaccgtccagctggcgatcgactacgcggtcaagcaccagaaggcctga

DBGET integrated database retrieval system