Roseateles sp. MS654: ACO228_13950 Help Entry ACO228_13950      CDS       T11465                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism roj  Roseateles sp. MS654 Pathway roj01100   Metabolic pathways roj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACO228_13950 (acpP)    00074 Mycolic acid biosynthesis     ACO228_13950 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACO228_13950 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XRE03867 LinkDB All DBs Position complement(3289262..3289501) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVPEADVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDYAVKHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcatcgccgagcaactcggcgtgcccgaa gccgatgtgaccaatgaaaaggccttcgtcgccgatctgggcgctgattctctggacacc gtggaattggtgatggccctcgaagacgagttcggcatcgagatcccggacgaagaggct gagaagatcaccaccgttcaactggcgatcgactacgcggtcaagcaccagaaggcgtaa

DBGET integrated database retrieval system