Roseovarius sp. AK1035: RAK1035_2952 Help Entry RAK1035_2952      CDS       T05517                                  Name (GenBank) Acyl carrier protein, putative   KO K02078   acyl carrier protein Organism rok  Roseovarius sp. AK1035 Pathway rok01100   Metabolic pathways rok01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rok00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RAK1035_2952    00074 Mycolic acid biosynthesis     RAK1035_2952   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RAK1035_2952 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AWZ21660 LinkDB All DBs Position 3047888..3048154 Genome browser AA seq 88 aa AA seqDB search MSHDTQDLEQEILDVLFERLSKFPVKSGALSADTSLVADMNLDSVNMMELLMEVEDTFDV SFPLNMMANVDTVQNLADQIKLLVEKKS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcacatgacacccaagaccttgaacaggaaatcctcgacgtgctgttcgagcgcctg tcgaaattcccggtgaaatccggcgcattgtctgcggacaccagccttgtcgccgatatg aaccttgattccgtcaatatgatggaattgctgatggaggttgaggacacctttgacgtc agctttccgctcaacatgatggccaatgtcgatacggtgcagaaccttgccgatcagatc aaactgcttgtggagaaaaaatcatga

DBGET integrated database retrieval system