Rosistilla oblonga: CA51_37520 Help Entry CA51_37520        CDS       T06941                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism rol  Rosistilla oblonga Pathway rol00190   Oxidative phosphorylation rol01100   Metabolic pathways Module rol_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rol00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CA51_37520 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rol00194]     CA51_37520 (atpE) Photosynthesis proteins [BR:rol00194]  Photosystem and electron transport system   F-type ATPase [OT]    CA51_37520 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QDV13861 LinkDB All DBs Position complement(5112975..5113220) Genome browser AA seq 81 aa AA seqDB search MLDFMMLLAQSSELGKMGAGLGMGLVILGASLGIGRIGGNAVDAIARQPEAGGRIGTNML IACALIEGVTVIALILEYILN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgttggacttcatgatgttgctggcacaatcgtcagaattgggcaagatgggcgctgga ttgggcatgggccttgtgatcctgggcgctagccttggcatcggacgcatcggcggcaac gctgtcgacgcgatcgcacgtcaacccgaagcgggcggacggatcggtacaaacatgctg atcgcttgtgctctgatcgaaggtgtgaccgtgatcgcgttgattcttgagtacattctc aattag

DBGET integrated database retrieval system