Roseovarius faecimaris: EI983_07645 Help Entry EI983_07645       CDS       T06338                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rom  Roseovarius faecimaris Pathway rom01100   Metabolic pathways rom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI983_07645    00074 Mycolic acid biosynthesis     EI983_07645   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI983_07645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QGX98158 UniProt:  A0A6I6IZW5 LinkDB All DBs Position 1485785..1486042 Genome browser AA seq 85 aa AA seqDB search MSIRDRVINIIAEQAVLEPEDVTMESTLESLGIDSLGLVESIFAIEEEFDISVPFNANAP SESDFDISSVASIVAGIEQLVKEQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatcagggatcgcgtcatcaacatcatcgccgaacaggcggtgcttgagccggaa gatgtgacgatggagagcacgctggaaagcctcggcatcgacagtctggggctggtggag agcatctttgccatcgaggaagagttcgacatttcggtgccgttcaatgccaacgcgccc agcgagagcgatttcgacatttcaagcgtggcctccattgtggcggggatcgaacagctg gtgaaagaacagtcgtga

DBGET integrated database retrieval system