Roseovarius faecimaris: EI983_10130 Help Entry EI983_10130       CDS       T06338                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rom  Roseovarius faecimaris Pathway rom01100   Metabolic pathways rom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI983_10130    00074 Mycolic acid biosynthesis     EI983_10130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI983_10130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QGX98614 UniProt:  A0A6I6IRA7 LinkDB All DBs Position complement(1979360..1979593) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVSENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVSFIKGAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaccgcgtgaaaaagatcgttgtggaacacctgggcgtggacgag gacaaggtttcggaaaacgcctcgttcatcgacgatctgggcgcggacagcctggacacg gtcgagctggtcatggccttcgaggaggagttcggcatcgagatccccgatgacgccgcc gagaccatccagacctttggcgatgcggtcagcttcatcaaaggcgcgtcgtaa

DBGET integrated database retrieval system