Roseimicrobium sp. ORNL1: G5S37_04825 Help Entry G5S37_04825       CDS       T06460                                  Name (GenBank) glutaredoxin family protein   KO K03676   glutaredoxin 3 Organism roo  Roseimicrobium sp. ORNL1 Brite KEGG Orthology (KO) [BR:roo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:roo03110]     G5S37_04825 Chaperones and folding catalysts [BR:roo03110]  Protein folding catalysts   Protein disulfide isomerase    G5S37_04825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Ish1 GST_N_2 Glrx-like Thioredoxin_3 SH3BGR YfjL_C CLIC-like_N Motif Other DBs NCBI-ProteinID:  QIF00872 UniProt:  A0A6G6K0A0 LinkDB All DBs Position complement(1181972..1182229) Genome browser AA seq 85 aa AA seqDB search MNVRLFVKSGCPWCDEAMEWLDDHGIEYTTLNVSADLEAREEMRELTGQTKAPSIDVDGE VLADFGADELEAWWDEKGYPVNPES NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacgtccgactgtttgtgaaatccgggtgcccctggtgtgatgaagcaatggaatgg ctggatgaccacggcatcgagtacaccacgctcaatgtctccgcggacctcgaagcacgc gaggaaatgcgcgagctcaccggccagaccaaggcccccagcattgatgtggatggcgaa gtccttgccgacttcggcgcggatgaactggaagcgtggtgggacgaaaagggctatccg gtgaatccggagagctga

DBGET integrated database retrieval system