Roseimicrobium sp. ORNL1: G5S37_18525 Help Entry G5S37_18525       CDS       T06460                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism roo  Roseimicrobium sp. ORNL1 Pathway roo01100   Metabolic pathways roo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5S37_18525    00074 Mycolic acid biosynthesis     G5S37_18525   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5S37_18525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QIF03437 UniProt:  A0A6G6K7L1 LinkDB All DBs Position complement(4565210..4565452) Genome browser AA seq 80 aa AA seqDB search MADSNISDKVRDIIVEQLGVNPEQVTPEAKFIEDLGADSLDTVELVMAFEEEFGIDVPDE EAEKLLSVADVIRYVEENAE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcagacagcaatatttcagacaaagtacgggacatcatcgtcgagcagctcggcgtg aatcccgagcaggtgactcccgaggcgaagttcatcgaagatctcggcgccgattcactg gatacggtggagctggtgatggccttcgaagaagagttcggcatcgacgtgccggatgaa gaagctgagaagcttctctccgtggcggacgtcatccgctatgtggaagagaacgccgaa taa

DBGET integrated database retrieval system