Roseimicrobium sp. ORNL1: G5S37_22150 Help Entry G5S37_22150       CDS       T06460                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism roo  Roseimicrobium sp. ORNL1 Pathway roo01100   Metabolic pathways roo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5S37_22150    00074 Mycolic acid biosynthesis     G5S37_22150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5S37_22150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIF04114 LinkDB All DBs Position 5490770..5491030 Genome browser AA seq 86 aa AA seqDB search MADLDAIKLQIKQAMVEELMLPQSAEEITDDALIFSPQGLGLDSVDALQLVVALEKRFGL KLPDAAAARETLRSVETIAEAVAAKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcagacctcgacgcgatcaagttgcagatcaaacaagcgatggtggaagagttgatg ctcccccagtccgccgaggagattaccgatgacgcgctcatcttcagcccccaaggtctg ggactcgatagcgtggacgccctgcaactcgtcgtggccctggaaaagcgcttcggcctg aagctcccggacgccgcagcagcgcgtgaaacactgcgctccgtggagaccatcgcggaa gcggtggcggcgaaggcttga

DBGET integrated database retrieval system