Rhodococcus opacus B4: ROP_07460 Help Entry ROP_07460         CDS       T00882                                  Name (GenBank) putative tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rop  Rhodococcus opacus B4 Pathway rop00362   Benzoate degradation rop00621   Dioxin degradation rop00622   Xylene degradation rop01100   Metabolic pathways rop01120   Microbial metabolism in diverse environments rop01220   Degradation of aromatic compounds Module rop_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:rop00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     ROP_07460    00622 Xylene degradation     ROP_07460    00621 Dioxin degradation     ROP_07460 Enzymes [BR:rop01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      ROP_07460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Agd3_C Tautomerase_3 YhfG Motif Other DBs NCBI-ProteinID:  BAH48993 UniProt:  C1ATY5 LinkDB All DBs Position complement(783768..783947) Genome browser AA seq 59 aa AA seqDB search MPLIQISQTPGLSAEQKRATIEAVTKAYADATGKDPAAVWVTITEVPRDSWGVGGTPLG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgccactcattcagatcagtcagacgccgggactttcggcggagcagaagcgcgccacg atcgaggcggtcacgaaggcctacgccgatgcgacgggtaaggatcccgcggcggtgtgg gtgacgatcaccgaggtgccgcgcgacagctggggtgtcggcgggacgccgctggggtga

DBGET integrated database retrieval system