Rhodococcus opacus B4: ROP_09230 Help Entry ROP_09230         CDS       T00882                                  Symbol acpM Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rop  Rhodococcus opacus B4 Pathway rop01100   Metabolic pathways rop01110   Biosynthesis of secondary metabolites Module rop_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) Brite KEGG Orthology (KO) [BR:rop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ROP_09230 (acpM)    00074 Mycolic acid biosynthesis     ROP_09230 (acpM)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ROP_09230 (acpM) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  BAH49170 UniProt:  C1AUG2 LinkDB All DBs Position 966123..966434 Genome browser AA seq 103 aa AA seqDB search MAATQEDIIAGLAEIIEEVTGIEPSEVTIEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIP DEDLAGLRTVGDAVSYIQKLEAEGGADAEAVKAKLEAAKNDEE NT seq 312 nt NT seq  +upstreamnt  +downstreamnt gtggccgccacccaggaagacatcatcgccggactcgcggagatcatcgaggaggtcacc ggtattgagccgtccgaggtgaccatcgaaaagtctttcgtcgacgacctcgacatcgac tccctctccatggttgagatcgccgtccagaccgaggacaagtacggcgtgaagatcccc gacgaggatctcgccggactgcgcaccgtcggtgacgccgtgtcctacatccagaagctc gaagcagaaggtggcgccgacgcggaggccgtcaaggccaagctcgaagctgccaagaac gacgaggagtga

DBGET integrated database retrieval system