Rhodococcus opacus B4: ROP_64420 Help Entry ROP_64420         CDS       T00882                                  Name (GenBank) glutaredoxin family protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism rop  Rhodococcus opacus B4 Brite KEGG Orthology (KO) [BR:rop00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     ROP_64420 Enzymes [BR:rop01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      ROP_64420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like Thioredoxin GST_N_3 Redoxin Motif Other DBs NCBI-ProteinID:  BAH54689 UniProt:  C1B1J4 LinkDB All DBs Position complement(7052634..7052888) Genome browser AA seq 84 aa AA seqDB search MTATDTPALTIYSTTWCGYCRRLKTQLDESGIGYVEIDIEDDPASAEFVGSVNGGNHVVP TVKFADGSTATNPSLAQVKQLLGV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgactgctaccgacaccccggccctgaccatctactccaccacctggtgcggctactgc cggcgcctgaagacgcagctggacgaatccggcatcggctacgtggagatcgacatcgag gacgatccggcgtcggcggagttcgtcggcagcgtcaacggcggcaaccacgtcgtgccc accgtcaagttcgccgacggcagcaccgcaaccaacccgtcgttggcgcaggtcaagcag cttctcggcgtctag

DBGET integrated database retrieval system