KEGG   Rhodococcus opacus B4: ROP_pROB02-01590
Entry
ROP_pROB02-01590  CDS       T00882                                 

Gene name
bnzA2
Definition
(GenBank) benzene dioxygenase small subunit
  KO
K15750  biphenyl 2,3-dioxygenase subunit beta [EC:1.14.12.18]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00621  Dioxin degradation
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
rop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    ROP_pROB02-01590 (bnzA2)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     ROP_pROB02-01590 (bnzA2)
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: BAD95524
NITE: ROP_pROB02-01590
UniProt: Q588I8
LinkDB
Position
pROB02:171604..172167
AA seq 187 aa
MIDAESPTTAFRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIR
TTRIMREAEQEYSGAHEYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVD
GDNPGEYHVSNVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILA
NNLSFFF
NT seq 564 nt   +upstreamnt  +downstreamnt
atgattgacgccgaatcgccaaccacggcatttcgaacaaaacccgcaccagtagacccc
agcctgcagcacgagatcgagcagttctactactgggaggcgaaacttctcaatgaccgc
cgcttccaagaatggttcgatctgttggccgaagatattcattacttcatgccaatccga
accacgcgtatcatgcgagaagccgaacaggagtattccggcgcccatgaatacgcacat
ttcgacgacaatgcgcagatgatgcgagggcgcctgcgcaagatcacttccgatgtgagc
tggtcagagaacccggcctcgcgcacgcggcacgtgatttccaacgtcatgatcgtcgac
ggtgataaccctggtgaataccacgtctcgaacgtcttcatcgtgtacagaaatcggctc
gagcggcagctcgatatcttcgctggggagcggaaggacattctgcgtcgaactggtagc
gaagcgggtttcgaactcgcgaagcgaacgatcctgatcgaccagagcacaattctcgcc
aacaacctcagcttcttcttctag

DBGET integrated database retrieval system