KEGG   Rhodococcus opacus B4: ROP_pROB02-01620
Entry
ROP_pROB02-01620  CDS       T00882                                 

Gene name
bnzC
Definition
(GenBank) catechol 2,3-dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00361  Chlorocyclohexane and chlorobenzene degradation
rop00621  Dioxin degradation
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
rop01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    ROP_pROB02-01620 (bnzC)
   00621 Dioxin degradation
    ROP_pROB02-01620 (bnzC)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     ROP_pROB02-01620 (bnzC)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3
Other DBs
NCBI-ProteinID: BAD95527
NITE: ROP_pROB02-01620
UniProt: Q588I5
LinkDB
Position
pROB02:174060..175013
AA seq 317 aa
MSVQRLGYMGFEVADVPAWRAFMTEKLGAMEASSSENSARFRIDSRSWRLMVEKGPSDDI
SLSGYEVESEDSLLAIKKRLEAHGIEVTTESGELADDRGVLGLISCTDTANTRVEIYYGA
TELFEKPFISPTGVSGFTTGDQGFGHYVLAVPDIDAALDFYVKGLGFHLSDIIDWKLNDE
LTVKLHFLHCNGRHHTLALAGLPGAKKTHHFMLETKHMDDVGLAYDKFDADGTVVMTLGR
HTNDHMLSFYGATPSGFAVEYGWGARQVEPGWSVVRYDKISIWGHKFVAERDRQVSSNAI
EDELIDIDATLSAPAQA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgagcgttcagagacttggttacatgggcttcgaggttgcggatgtgcccgcatggcgc
gccttcatgacggaaaaactgggggccatggaggcctcgagcagcgagaattcggcgcgg
ttcaggattgactcccgcagctggcgcctgatggtcgaaaagggaccgtcggatgacatc
tcgctctcgggctacgaggtcgagagcgaggactcgctactcgcgatcaaaaagcgtctc
gaagcgcatggaatcgaggtgacaacagagagcggcgagttggcggacgatcgcggtgtc
ctcggactgatttcgtgcacggacacggcaaacacccgggtcgagatctactatggcgcg
acggagctgttcgagaagccgttcatctcgccgaccggggtctcgggcttcacgaccggc
gaccaggggttcggccactacgtgctggctgtgccggatatagatgctgccctggatttc
tatgtcaagggcctgggcttccatctctccgacatcatcgactggaagctcaacgatgaa
ctgacggtcaaactccacttcctgcactgcaacggtcgacaccacaccctggcgctcgcc
ggtctcccgggagcaaagaagactcaccacttcatgctcgagaccaagcatatggatgac
gtgggccttgcctacgacaagttcgatgcggacgggacagtggtcatgacgcttggccgc
cacaccaatgaccacatgctctcattctacggcgcgaccccctccggatttgccgtcgaa
tacggctggggcgctcgccaggtcgaaccaggctggtccgtcgtgcgctacgacaagatc
agcatctggggtcacaaattcgttgccgagcgcgacaggcaagtgagcagcaacgcaatc
gaggatgaattgattgacatcgatgccacgctgagcgccccggcgcaagcgtaa

DBGET integrated database retrieval system