Raoultella ornithinolytica B6: RORB6_09200 Help Entry RORB6_09200       CDS       T02625                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ror  Raoultella ornithinolytica B6 Pathway ror01100   Metabolic pathways ror01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ror00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RORB6_09200    00074 Mycolic acid biosynthesis     RORB6_09200   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RORB6_09200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AGJ86529 LinkDB All DBs Position complement(2033750..2033986) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccactgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system