Klebsiella ornithinolytica B6: RORB6_20215 Help Entry RORB6_20215       CDS       T02625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ror  Klebsiella ornithinolytica B6 Pathway ror01100   Metabolic pathways ror01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ror00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RORB6_20215    00074 Mycolic acid biosynthesis     RORB6_20215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RORB6_20215 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding GshA MerR_2 Motif Other DBs NCBI-ProteinID:  AGJ88723 LinkDB All DBs Position complement(4470865..4471116) Genome browser AA seq 83 aa AA seqDB search MTESHDIYADVSALLVKLFEIDPEDIKPEARLYEDLELDSIDAVDMIVHLQKKTSKKIKA EEFKAVRTVQDVVDALERLSREA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgaatcacatgatatttatgccgacgtctcggcactgctggttaagctgttcgag atcgatcctgaagacatcaaaccggaagcgcggctgtacgaagacctggagctggatagc atcgacgcggtcgatatgatcgtccacctgcagaagaaaaccagcaagaaaatcaaagca gaagaatttaaagccgtgcgtaccgtgcaggatgtggttgatgccctcgaacgcctgtcc cgggaagcctga

DBGET integrated database retrieval system