Raoultella ornithinolytica B6: RORB6_20220 Help Entry RORB6_20220       CDS       T02625                                  Name (GenBank) acyl Carrier protein   KO K02078   acyl carrier protein Organism ror  Raoultella ornithinolytica B6 Pathway ror01100   Metabolic pathways ror01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ror00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RORB6_20220    00074 Mycolic acid biosynthesis     RORB6_20220   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RORB6_20220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGJ88724 LinkDB All DBs Position complement(4471127..4471384) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLEELSADDIDTDAALFGDGLGLDSIDALELGLAVKNRYGVVLS AESDEMRQHFFSVATLAAFIDAQRT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctcataattactacgttgaatctggaagaa ctgtcggctgacgacattgacaccgatgcggcactctttggcgatggcctgggtctggat tccatcgacgccctggagctggggctggcggtaaaaaaccgctacggcgtggtgctctcc gccgaaagcgacgagatgcgccagcatttcttctccgttgccaccctggccgcgtttatc gacgctcaacgtacctga

DBGET integrated database retrieval system