Roseomonas sp. FDAARGOS_362: CTJ15_01665 Help Entry CTJ15_01665       CDS       T05160                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ros  Roseomonas sp. FDAARGOS_362 Pathway ros00998   Biosynthesis of various antibiotics ros01100   Metabolic pathways ros01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ros00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTJ15_01665    00074 Mycolic acid biosynthesis     CTJ15_01665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTJ15_01665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ATR19088 UniProt:  A0A2D2GZ91 LinkDB All DBs Position unnamed1:complement(361826..362077) Genome browser AA seq 83 aa AA seqDB search MLDERAALREITAALEETGKLTGPVTMDTNILKDLNFDSVGAVDFIMVLETRLDIIIPMD RMTEIETIGDLVRVVTSDPSLAS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctggatgagcgggccgccctacgggaaatcaccgcggccttggaagagacggggaag ctgacaggccccgtcaccatggacacgaacatcctcaaggacctgaatttcgactccgtg ggtgccgtcgatttcatcatggtgctggagacccgtctggacatcatcatcccgatggac cggatgacggagatagagaccatcggcgacctcgtccgggtcgtgaccagcgatcccagc ctggcctcctga

DBGET integrated database retrieval system