Roseomonas sp. FDAARGOS_362: CTJ15_21535 Help Entry CTJ15_21535       CDS       T05160                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ros  Roseomonas sp. FDAARGOS_362 Pathway ros00998   Biosynthesis of various antibiotics ros01100   Metabolic pathways ros01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ros00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CTJ15_21535    00074 Mycolic acid biosynthesis     CTJ15_21535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CTJ15_21535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATR22637 UniProt:  A0A2D2H9E7 LinkDB All DBs Position 3757390..3757647 Genome browser AA seq 85 aa AA seqDB search MMAGTAEADLAARFEAVLRRAFPGFRGAFHAGLAAADVAGWDSVAHVNLLMDLEDAFGVE IPPGAAAQVPDVGGLMALVRERLPG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgatggctggaaccgcggaggccgatctcgccgcgcgcttcgaggcggtgctgcgccgg gccttcccgggcttccgcggcgccttccacgcggggctggccgccgccgacgtggccggc tgggattcggtcgcgcatgtgaacctgctgatggacctggaggacgccttcggcgtcgag atcccgcccggggcggcggcgcaggtgccggatgtgggcgggctgatggcgctggtgcgg gaacgcctgccgggctga

DBGET integrated database retrieval system