Roseivivax sp. THAF197b: FIV09_05370 Help Entry FIV09_05370       CDS       T06253                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rot  Roseivivax sp. THAF197b Pathway rot01100   Metabolic pathways rot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FIV09_05370    00074 Mycolic acid biosynthesis     FIV09_05370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FIV09_05370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QFS82251 UniProt:  A0A5P8YZW0 LinkDB All DBs Position 1050864..1051124 Genome browser AA seq 86 aa AA seqDB search MDVKTKVVEILADQAVLEPSDVDMDMTLEDLGIDSMALVESIFAIEEAFDISVPFNANAP GESGFDISSVRKIVAEVERLVAEQHA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggatgtgaagacgaaggttgttgaaattctggccgatcaggcggtgctcgagccgtcg gatgtggacatggacatgacgcttgaggatctgggcatcgattccatggcgctggtggaa tcgatcttcgccatcgaggaagccttcgatatctccgtgccgttcaacgccaacgccccc ggggaaagcggcttcgatatctcatccgtgcgcaagatcgtcgccgaggtcgagcggctg gtcgccgaacagcacgcgtga

DBGET integrated database retrieval system