Rahnella sikkimica: BV494_07625 Help Entry BV494_07625       CDS       T05331                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rox  Rahnella sikkimica Pathway rox01100   Metabolic pathways rox01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rox00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BV494_07625    00074 Mycolic acid biosynthesis     BV494_07625   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BV494_07625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AVF34809 UniProt:  A0A2L1UPE6 LinkDB All DBs Position complement(1717929..1718177) Genome browser AA seq 82 aa AA seqDB search MAQYDEVYEKVSEMLCDAKDLEPDALTPDSPLHQLKLDSLDYVELMVLAKKEFGVSVEAD LFINNPHISLRELCQYLSDHSQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcgcaatacgatgaagtttatgaaaaagttagcgaaatgctgtgcgatgcgaaagat ctggaacccgatgccttaacgcctgactcgccgcttcaccagctcaagctggacagcctc gattatgtcgaactgatggtgctggcgaaaaaggaatttggcgtgtcggtggaagccgat ttgttcatcaacaatccgcacatttcactgcgcgaattgtgccagtacctcagcgatcac agtcaataa

DBGET integrated database retrieval system