Rahnella sikkimica: BV494_11850 Help Entry BV494_11850       CDS       T05331                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism rox  Rahnella sikkimica Brite KEGG Orthology (KO) [BR:rox00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rox03032]     BV494_11850    03036 Chromosome and associated proteins [BR:rox03036]     BV494_11850    03400 DNA repair and recombination proteins [BR:rox03400]     BV494_11850 DNA replication proteins [BR:rox03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BV494_11850 Chromosome and associated proteins [BR:rox03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BV494_11850 DNA repair and recombination proteins [BR:rox03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BV494_11850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AVF35578 UniProt:  A0A2L1URZ1 LinkDB All DBs Position complement(2566004..2566279) Genome browser AA seq 91 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRVLDAVLASVTDTLKAGDEVALVGFGTFSVRERSARTG RNPQTGKEISIAAAKVPGFRAGKALKDAVNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtcacaattgatcgacaaaattgctgccggtgctgatatttctaaagccgca gcgggacgtgttttggatgctgttcttgcatctgtcactgacaccctgaaagctggggat gaagtcgctctggttggtttcggtactttctcagtgcgtgaacgttcagcacgtaccggc cgtaacccgcagaccggtaaagaaatcagtattgcagcagctaaagtgcctggcttccgt gcaggtaaagcgctgaaagatgccgttaacggttaa

DBGET integrated database retrieval system