Rahnella sikkimica: BV494_22400 Help Entry BV494_22400       CDS       T05331                                  Name (GenBank) Tautomerase PptA   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rox  Rahnella sikkimica Pathway rox00362   Benzoate degradation rox01100   Metabolic pathways rox01120   Microbial metabolism in diverse environments rox01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:rox00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BV494_22400    00622 Xylene degradation     BV494_22400    00621 Dioxin degradation     BV494_22400 Enzymes [BR:rox01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BV494_22400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  AVF37673 UniProt:  A0A2L1UXJ2 LinkDB All DBs Position unnamed1:218955..219185 Genome browser AA seq 76 aa AA seqDB search MPHIDLKFYPRGLSEEATQKLVDDLSAVLINHLGTTDKAISVMLTEVQPDAWKSDVYDPV IKPALEQMAKKPGYTL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccacatattgatttgaaattttatccgcgcggactttctgaagaagcgacgcagaaa ctggtcgatgacctttccgccgtgttgatcaatcatctgggaacgacggacaaagccatc tccgtcatgctgaccgaagttcagccggatgcgtggaaaagcgatgtgtatgatccggtc atcaaaccggcattagaacagatggcgaaaaaacccggttataccctgtaa

DBGET integrated database retrieval system