Rhizobium oryzihabitans: G3A56_05350 Help Entry G3A56_05350       CDS       T06770                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism roy  Rhizobium oryzihabitans Pathway roy01100   Metabolic pathways roy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:roy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G3A56_05350    00074 Mycolic acid biosynthesis     G3A56_05350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G3A56_05350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  QIB37484 UniProt:  A0A7L5BF01 LinkDB All DBs Position M15-11:complement(999773..1000009) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgtaattgatcatcttggcgttgacgcc gacaaggttgttgaaggcgctagcttcattgacgatctgggcgctgattcgctcgatacc gttgaactggtcatggctttcgaagaagaattcggcgtcgaaattcccgacgacgcagct gactcgatcctgactgtcggcgacgccgtcaagttcatcgagaaggcccaggcctga

DBGET integrated database retrieval system