Rhizobium oryzihabitans: G3A56_19350 Help Entry G3A56_19350       CDS       T06770                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism roy  Rhizobium oryzihabitans Brite KEGG Orthology (KO) [BR:roy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:roy03110]     G3A56_19350 (grxC) Chaperones and folding catalysts [BR:roy03110]  Protein folding catalysts   Protein disulfide isomerase    G3A56_19350 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like SH3BGR GST_N_2 Motif Other DBs NCBI-ProteinID:  QIB40084 UniProt:  A0A7L5BMF7 LinkDB All DBs Position M15-12:complement(579950..580204) Genome browser AA seq 84 aa AA seqDB search MAPVTIYTRDFCGYCARAKALLDSKGVDYAEYNATTTPEYRQEMIEKSGGTTFPQIFING EHVGGCDDLHALERAGKLDEMLAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcaccggtgacgatctatacgcgggatttttgtggttattgcgcgcgcgccaaggcg ctgctggacagcaagggcgtcgactacgccgaatacaacgccacgacgacgccggaatac cggcaggaaatgatcgaaaaatccggcggcacgaccttcccgcaaatcttcatcaatggc gagcatgtcggcggttgcgacgatctgcatgcactggagcgtgccggtaaactcgacgaa atgctggccgcctga

DBGET integrated database retrieval system