KEGG   Rhodococcus oxybenzonivorans: CBI38_14155
Entry
CBI38_14155       CDS       T08279                                 
Name
(GenBank) bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
roz  Rhodococcus oxybenzonivorans
Pathway
roz00621  Dioxin degradation
roz01100  Metabolic pathways
roz01120  Microbial metabolism in diverse environments
roz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:roz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CBI38_14155
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AWK72538
UniProt: A0A2S2BVI6
LinkDB
Position
3011136..3011459
AA seq 107 aa
MPLTRICNSNDLPPGEMLRFEGGAEPILVSNVDGEFFAVQDTCSHDEWSLAEGMLEGGVV
ECTLHWAKFCVRTGKVKALPASVPLRTFATKVEGDEVFVELDSEATV
NT seq 324 nt   +upstreamnt  +downstreamnt
atgcctctcacacggatctgtaactcgaacgacctaccaccgggtgaaatgctgcgcttc
gaaggtggcgcggagcccatcttggtttccaatgtcgacggagagttcttcgcagtccag
gacacctgttcgcacgacgagtggtcgctcgccgagggaatgctcgagggcggtgtcgtc
gagtgcacattgcactgggcgaagttctgtgtacgaacaggcaaggtgaaggctttgccc
gcctccgtacctctccgcaccttcgcgaccaaagtcgagggagacgaagtgttcgtcgaa
ctggacagcgaagcgacagtctga

DBGET integrated database retrieval system