KEGG   Rhodopseudomonas palustris CGA009: TX73_024820
Entry
TX73_024820       CDS       T00153                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
rpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TX73_024820 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rpa02022]
    TX73_024820 (phoB)
Two-component system [BR:rpa02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   TX73_024820 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C GerE
Other DBs
NCBI-ProteinID: WCL94982
UniProt: Q6N0I7
LinkDB
Position
complement(5390651..5391364)
AA seq 237 aa
MAARILVVEDEEALTTLLRYNLESEGYEVETVARGDDADTRMKERIPDLVVLDWMLPGLS
GIELCRRLRARPETKQLPIIMLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLL
RRAAPERLATVLAYGDLELDRDKRRVARSGRPIDLGPTEYRLLEFFLEHPGRVFSREQLL
DGVWGRDIYIDERTVDVHIGRLRKLLNIGREQDPIRTVRGAGYALDDRFAKVEGSPS
NT seq 714 nt   +upstreamnt  +downstreamnt
atggctgcgcgcattctggtagttgaagacgaggaagcgctgacgacgctgctgcgatac
aatctggaatccgagggctacgaggtcgagacggtggcccgcggcgacgatgccgacacc
cggatgaaagagcgcattcccgatctggtggtgttggactggatgttgccgggcctgtcc
ggcatcgagctgtgccgccggctgcgggcgcggccggaaaccaagcagctgccgatcatc
atgctgacagcgcgcggcgaagagagcgaacgcgttcgcgggctcgcgaccggtgccgac
gattacatcgtcaagccgttttcggtgccggagctgctggcgcgggtgaagggcctgctg
cgccgcgcggcgccggagcggctcgccaccgtgctggcctatggcgatctcgagctcgac
cgcgacaagcggcgggtcgcgcgttccggccggccgatcgatctcggcccgaccgagtat
cgcttgctcgagttcttcctggagcatccgggccgggtgttcagccgcgaacagctgctc
gacggcgtctgggggcgcgacatctatatcgatgagcgcaccgtcgacgtgcacatcggc
cgcctccgcaagctgctcaatatcggccgcgagcaggatccgatccgcaccgtccgcggt
gccggctacgccctcgacgaccgctttgccaaggtcgaaggcagcccgtcgtag

DBGET integrated database retrieval system