Ruminiclostridium papyrosolvens: P0092_03265 Help Entry P0092_03265       CDS       T08965                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpay  Ruminiclostridium papyrosolvens Pathway rpay01100   Metabolic pathways rpay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P0092_03265    00074 Mycolic acid biosynthesis     P0092_03265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P0092_03265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACP_SdgA_C PP-binding Motif Other DBs NCBI-ProteinID:  WES35012 LinkDB All DBs Position 689691..689930 Genome browser AA seq 79 aa AA seqDB search MKEKVLQKIIERASEIWAVDASTLNCDTQFADMNPKSTHYSQITTYLEDEFDIEVPYINF KRCKTLGEAADYVVELLEE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaaagaaaaagtattacaaaaaataattgaaagagcaagcgaaatatgggcagttgat gcatcaacattaaattgtgatacgcaatttgcagatatgaatcctaaatcaacgcattat tcacagattaccacctatttggaagatgaatttgatatagaagttccgtatataaatttt aaacgatgcaaaacacttggtgaagcagctgattatgttgttgagttattagaagaatag

DBGET integrated database retrieval system