Ruminiclostridium papyrosolvens: P0092_17310 Help Entry P0092_17310       CDS       T08965                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpay  Ruminiclostridium papyrosolvens Pathway rpay01100   Metabolic pathways rpay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P0092_17310    00074 Mycolic acid biosynthesis     P0092_17310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P0092_17310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C OB_RNR_1st CodY Motif Other DBs NCBI-ProteinID:  WES33507 LinkDB All DBs Position complement(3866897..3867154) Genome browser AA seq 85 aa AA seqDB search MKEQIYNQVCEMLKEVLQKDKYIFNENTVLLGQGGIMDSLTITSFINKIESNFKVDIIEE DLELECLETVGSLTDFLFDSGCSDK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaggaacaaatatacaatcaggtgtgtgaaatgctgaaggaagtacttcaaaaagat aaatatattttcaatgaaaatacagtattacttggacagggcggaattatggactctttg accattaccagttttattaataaaatagagagcaattttaaagtagatataatagaagag gacttggaactggaatgcttggaaaccgtgggtagcctaactgattttttgtttgacagc ggttgttcggataaataa

DBGET integrated database retrieval system