Rhodopseudomonas palustris BisB18: RPC_2301 Help Entry RPC_2301          CDS       T00336                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpc  Rhodopseudomonas palustris BisB18 Pathway rpc00998   Biosynthesis of various antibiotics rpc01100   Metabolic pathways rpc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RPC_2301    00074 Mycolic acid biosynthesis     RPC_2301   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RPC_2301 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ABD87855 UniProt:  Q215T1 LinkDB All DBs Position 2501056..2501295 Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDGASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagatcgtggtggagcaccttggtgtcgagccc gagaaagtggtcgacggcgcgagcttcattgacgacctcggtgcggacagcctcgacacc gtcgagctcgtgatggcgttcgaagaagaattcggctgcgaaattcccgacgatgccgca gaaaccattctgacggttggcgacgccaccaagtttctcgaaaagaacgcaaagagctga

DBGET integrated database retrieval system