Rhodopseudomonas palustris BisB18: RPC_2582 Help Entry RPC_2582          CDS       T00336                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism rpc  Rhodopseudomonas palustris BisB18 Pathway rpc02024   Quorum sensing rpc03018   RNA degradation Brite KEGG Orthology (KO) [BR:rpc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RPC_2582  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RPC_2582  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rpc03019]     RPC_2582    03036 Chromosome and associated proteins [BR:rpc03036]     RPC_2582 Messenger RNA biogenesis [BR:rpc03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RPC_2582 Chromosome and associated proteins [BR:rpc03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RPC_2582 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  ABD88132 UniProt:  Q214Q4 LinkDB All DBs Position 2805552..2805800 Genome browser AA seq 82 aa AA seqDB search MAADRAQNLQDTFLNHVRKTKTPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKH AISTIMPGAPIQLFEGGEDAPA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcggccgaccgcgcacagaatctacaggatacttttctcaaccacgtacgtaagacc aaaacgccactcacgatctttctggtcaacggggtcaagctgcaaggcattgtcacctgg ttcgacaatttctgcctgctgctgcggcgcgacggacattcgcagctggtctacaagcat gcgatctccaccatcatgccgggtgctccgatccagctgttcgaaggtggcgaggacgcc ccagcttga

DBGET integrated database retrieval system